PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G13960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 164aa    MW: 18643.7 Da    PI: 9.3595
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G13960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.81.2e-121048240
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                     +i n+  r  t  +R +g+lKK +E+S+LC+++++++++
  LPERR01G13960.1 10 PITNQVARRSTHERRTAGLLKKVQEVSILCNVRACIVVY 48
                     799**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.9E-6161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.073149IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-15491IPR002100Transcription factor, MADS-box
PfamPF003191.8E-111156IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MPLRKVTIEP ITNQVARRST HERRTAGLLK KVQEVSILCN VRACIVVYNI GDDTEPKAWP  60
SLPEATNILE DAMDITESSI GKRMLDTESL LRLNITEAEK KLRNKRAENC QLEINMIMND  120
VISGRRKNLD DLDPQLIGDI QMVLAMRHLA IRNRINVLRS KTAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9V1071e-116A0A0D9V107_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1651545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.23e-20M-type_MADS family protein